Gene/Protein
Disease
Symptom
Drug
Enzyme
Compound
Pivot Concepts:
Gene/Protein
Disease
Symptom
Drug
Enzyme
Compound
Target Concepts:
Gene/Protein
Disease
Symptom
Drug
Enzyme
Compound
Query: UMLS:C0027960 (
mole
)
21,279
document(s) hit in 31,850,051 MEDLINE articles (0.00 seconds)
Under the narrow range of experimental conditions, and at a temperature of approximately 25 degrees, the following data were obtained. 1. The equilibrium constant of peroxidase and hydrogen peroxide has a minimum value of 2 x 10(-8). 2. The velocity constant for the formation of peroxidase-
H2O2
Complex I is 1.2 x 10(7) liter
mole
-1 sec.-1, +/- 0.4 x 10(7). 3. The velocity constant for the reversible breakdown of peroxidase-
H2O2
Complex I is a negligible factor in the enzyme-substrate kinetics and is calculated to be less than 0.2 sec.-1. 4. The velocity constant, k3, for the enzymatic breakdown of peroxidase-
H2O2
Complex I varies from nearly zero to higher than 5 sec.-1, depending upon the acceptor and its concentration. The quotient of k3 and the leucomalachite green concentration is 3.0 x 10(4) liter
mole
-1 sec.-1. For ascorbic acid this has a value of 1.8 x 10(5) liter
mole
-1 sec.-1. 5. For a particular acceptor concentration, k3 is determined solely from the enzyme-substrate kinetics and is found to be 4.2 sec.-1. 6. For the same conditions, k3 is determined from a simple relationship derived from mathematical solutions of the Michaelis theory and is found to be 5.2 sec.-1. 7. For the same conditions, k3 is determined from the over-all enzyme action and is found to be 5.1 sec.-1. 8. The Michaelis constant determined from kinetic data alone is found to be 0.44 x 10(-6). 9. The Michaelis constant determined from steady state measurements is found to be 0.41 x 10(-6). 10. The Michaelis constant determined from measurement of the overall enzyme reaction is found to be 0.50 x 10(-6). 11. The kinetics of the enzyme-substrate compound closely agree with mathematical solutions of an extension of the Michaelis theory obtained for experimental values of concentrations and reaction velocity constants. 12. The adequacy of the criteria by which experiment and theory were correlated has been examined critically and the mathematical solutions have been found to be sensitive to variations in the experimental conditions. 13. The critical features of the enzyme-substrate kinetics are Pmax, and curve shape, rather than t1/2. t1/2 serves as a simple measure of dx/dt. 14. A second order combination of enzyme and substrate to form the enzyme-substrate compound, followed by a first order breakdown of the compound, describes the activity of peroxidase for a particular acceptor concentration. 15. The kinetic data indicate a bimolecular combination of acceptor and enzyme-substrate compound.
...
PMID:The kinetics of the enzyme-substrate compound of peroxidase. 1943. 1021 4
The peroxidase from Coprinus cinereus (CPX) catalyzed oxidative oligomerization of 4-chloroaniline (4-CA) forming several products: N-(4-chlorophenyl)-benzoquinone monoamine (dimer D), 4,4'-dichloroazobenzene (dimer E); 2-(4-chloroanilino)-N-(4-chlorophenyl)-benzoquinone (trimer F); 2-amino-5-chlorobenzoquinone-di-4-chloroanil (trimer G); 2-(4-chloroanilino)-5-hydroxybenzoquinone-di-4-chloroanil (tetramer H) and 2-amino-5-(-4-chlroanilino)-benzoquinone-di-4-chloroanil (tetramer 1). In the presence of 4-CA and
H2O2
, CPX was irreversibly inactivated within 10 min. Inactivation of CPX in the presence of
H2O2
was a time-dependent, first-order process when the concentration of 4-CA was varied between 0 and 2.5 mM. The apparent dissociation constant (Ki) for CPX and 4-CA was 0.71 mM. The pseudo-first order rate constant for inactivation (k(inact)), was 1.15 x 10(-2) s(-1). Covalent incorporation of 20
mole
14C-4-CA per
mole
of inactivated CPX was observed. The partition ratio was about 2200 when either 4-CA or
H2O2
was used as the limiting substrate. These results show that 4-CA is a metabolically activated inactivator (i.e. a suicide substrate). Unmodified heme and hydroxymethyl heme were isolated from native, 4-CA-inactivated and
H2O2
-incubated CPX. Inactivation resulted in significant losses in both heme contents. Analysis of tryptic peptides from 4-CA-inactivated CPX by MALDI-TOF/ MS and UV-VIS spectrophotometry suggested that trimer G and tetramer H were the major 4-CA derivatives that were covalently bound, including to a peptide (MGDAGF-SPDEVVDLLAAHSLASQEGLNSAIFR) containing the heme binding site. These studies show that heme destruction and covalent modification of the polypeptide chain are both important for the inactivation of CPX. These results were compared with similar studies on 4-CA-inactivated horseradish peroxidase (HRP) and bovine lactoperoxidase (LPO) during the oxidation of 4-CA.
...
PMID:Inactivation of Coprinus cinereus peroxidase by 4-chloroaniline during turnover: comparison with horseradish peroxidase and bovine lactoperoxidase. 1065 39
Dendrimeric polyphenylsulfides, -selenides, and -tellurides are prepared in high yield using propyloxy spacers to connect the phenylchalcogeno groups to the dendrimeric core. The selenides and tellurides catalyze the oxidation of bromide with hydrogen peroxide to give positive bromine species that can be captured by cyclohexene in two-phase systems. The corresponding sulfides show no catalytic activity. The increase in the rate of catalysis followed statistical effects for 1, 6, and 12 phenyltelluro groups. However, the increase in the rate of catalysis exceeds statistical contributions for the first few generations with 1, 3, 6, and 12 phenylseleno groups and suggested cooperativity among phenylseleno groups. The increase in catalytic rate was lost upon replacing all but one phenylseleno group with phenoxy groups. On the basis of
H2O2
consumed, the dendrimer with 12 phenylseleno groups has a turnover number of >60 000 mol of
H2O2
consumed per
mole
of catalyst.
...
PMID:Dendrimeric organochalcogen catalysts for the activation of hydrogen peroxide: improved catalytic activity through statistical effects and cooperativity in successive generations. 1127 1
[see reaction]. A new triphase catalyst has been developed. When an aqueous solution of H3PW12O40 (1) was added to a solution of the amphiphilic chain copolymer 2, a new self-assembled and macroporous complex 3 was formed. This complex was effective as a catalyst in the epoxidation of allylic alcohols. Even in the use of 2.7 x 10(-5)
mole
equiv of the catalyst, the epoxidation with aqueous
H2O2
proceeded without organic solvents to give the corresponding epoxy alcohols in high yields.
...
PMID:Development of a new triphase catalyst and its application to the epoxidation of allylic alcohols. 1140 24
Recently we reported that antibodies can generate hydrogen peroxide (
H2O2
) from singlet molecular oxygen (1O2*). We now show that this process is catalytic, and we identify the electron source for a quasi-unlimited generation of
H2O2
. Antibodies produce up to 500
mole
equivalents of
H2O2
from 1O2*, without a reduction in rate, and we have excluded metals or Cl- as the electron source. On the basis of isotope incorporation experiments and kinetic data, we propose that antibodies use H2O as an electron source, facilitating its addition to 1O2* to form H2O3 as the first intermediate in a reaction cascade that eventually leads to
H2O2
. X-ray crystallographic studies with xenon point to putative conserved oxygen binding sites within the antibody fold where this chemistry could be initiated. Our findings suggest a protective function of immunoglobulins against 1O2* and raise the question of whether the need to detoxify 1O2* has played a decisive role in the evolution of the immunoglobulin fold.
...
PMID:Antibody catalysis of the oxidation of water. 1154 48
Burkholderia cepacia strain ST-200 produces an extracellular cholesterol oxidase which is stable and highly active in the presence of organic solvents. This cholesterol oxidase produces 6beta-hydroperoxycholest-4-en-3-one from cholesterol, with the consumption of two moles of O2 and the formation of one
mole
of
H2O2
. The structural gene encoding the cholesterol oxidase was cloned and sequenced. The primary translation product was predicted to be 582 amino acid residues. The mature product is composed of 539 amino acid residues and is preceded by a signal sequence of 43 residues. The cloned gene was expressed as an active product in Escherichia coli and the product was localized in the periplasmic space. The cholesterol oxidase produced from E. coli was purified to homogeneity from the periplasmic fraction. The purified enzyme was highly stable in the presence of various organic solvents or detergents, as compared with the commercially available cholesterol oxidases tested.
...
PMID:Cloning, sequence analysis and expression of a gene encoding an organic solvent- and detergent-tolerant cholesterol oxidase of Burkholderia cepacia strain ST-200. 1169 12
The reaction mechanism of the oxidative degradation of polyvinyl alcohol (PVA) by the photochemically enhanced Fenton reaction was studied using a homogeneous (Fe2+(aq) +
H2O2
) and a heterogeneous reaction system (iron(III)-exchanged zeolite Y+
H2O2
). In the homogeneous Fenton system, efficient degradation was observed in a batch reactor, equipped with a medium pressure mercury arc in a Pyrex envelope and employing 80% of the stoichiometric amount of
H2O2
required for the total oxidation of PVA and a concentration ratio as low as I
mole
of iron(II) sulfate per 20 moles of PVA sub-units (C2H40). Model PVA polymers of three different molecular weights (15,000, 49,000 and 100,000 g mol(-1)) were found to follow identical degradation patterns. Strong experimental evidence supports the formation of supermacromolecules (MW: 1-5 x 10(6) g/mol) consisting of oxidized PVA and trapped iron(III) at an early reaction stage. Low molecular weight intermediates, such as oxalic acid, formic acid or formaldehyde were not found during PVA degradation in the homogeneous Fenton system, and we may deduce that the manifold of degradation reactions is mainly taking place within the super-macromolecules from which CO2 is directly released. However, in the heterogeneous Fenton system, the reaction behavior was found to be distinctly different: a decrease of the molecular weights of all three tested monodisperse PVA samples was observed by the broadening of the GPC-traces during irradiation, and oxalic acid was formed. The results lead to the mechanistic hypothesis that during the heterogeneous Fenton process, the cleavage of the PVA-chains may occur at random positions, the reactive centres being located inside the iron(III)-doped zeolite Y photocatalysts.
...
PMID:Degradation of polyvinyl alcohol (PVA) by homogeneous and heterogeneous photocatalysis applied to the photochemically enhanced Fenton reaction. 1169 68
High plasma homocysteine concentrations have been found to be associated with atherosclerosis and thrombosis of arteries and deep veins. The oxidative damage mediated by hydrogen peroxide production during the metal-catalyzed oxidation of homocysteine is to date considered to be one of the major pathophysiological mechanisms for this association. In this work, a very sensitive and accurate method was employed to measure the effective production of
H2O2
during homocysteine oxidation. Furthermore, the interaction of homocysteine with powerful oxidizing species (hypochlorite, peroxynitrite, ferrylmyoglobin) was evaluated in order to ascertain the putative pro-oxidant role of homocysteine. Our findings indicate that homocysteine does not produce
H2O2
in a significant amount (1/4000
mole
/
mole
ratio of
H2O2
to homocysteine). Moreover, homocysteine strongly inhibits the oxidation of luminol and dihydrorhodamine by hypochlorite or peroxynitrite and rapidly reduces back ferrylmyoglobin, the oxidizing species, to metmyoglobin. All these results should, in our opinion, lead to a rethinking of the commonly held view that homocysteine oxidation is one of the main causative mechanisms of cardiovascular damage.
...
PMID:Is homocysteine a pro-oxidant? 1176 8
The system Fe(III)/
H2O2
has been used to oxidise an aqueous solution of p-hydroxybenzoic acid (pHB) in the absence of light. In the process, typical operating variables such as reagent concentration exert a positive influence in the pHB degradation rate. Optimum pH has been found to be around 3. The kinetic study suggests that the mechanism involved in this system differs to some extent from that reported for the classic Fenton's chemistry in pure water. Thus, formation of a complex Fe(III)-pHB seems to be a key step to initiate the oxidising mechanism. Stoichiometric measurements of the
H2O2
consumption per
mole
of pHB degraded indicate a possible reduction of complexed Fe(III). Simultaneous oxidation of pHB (and other similar compounds such as tyrosol (Ty) or p-coumaric acid (pCu)) and atrazine have shown a synergistic effect of the first substance to remove the pesticide.
...
PMID:Co-oxidation of p-hydroxybenzoic acid and atrazine by the Fenton's like system Fe(III)/H2O2. 1190 Sep 11
This paper describes a study of oxidation of diethylene glycol (DEG) by ozone and modified Fenton process (hydrogen peroxide and ferric salt mixture) in aqueous solution. Both oxidation processes were able to oxidize relatively high concentrations of DEG effectively. DEG reacted primarily through hydroxyl radical produced by decomposition of ozone, and about 3 mol of ozone were consumed per
mole
of DEG removed during the process. For modified Fenton oxidation, stepwise addition of hydrogen peroxide (
H2O2
) and ferric salt (Fe(III)) resulted in much higher removal of DEG than one-time pulse addition of the chemicals. The extent of DEG removal increased with increasing concentrations of both
H2O2
and Fe(III). Oxidant consumption per
mole
of DEG oxidized was one order of magnitude higher for hydrogen peroxide than those observed for ozone. Overall, ozonation produced higher concentrations of aldehydes, and modified Fenton treatment produced higher concentrations of carboxylic acids for the same levels of DEG oxidation. The major products of ozonation were glycolaldehyde, glyoxal, formaldehyde, acetaldehyde, and acetic, formic, pyruvic, oxalic and glyoxalic acids. The major products of modified Fenton oxidation were formaldehyde, and formic and acetic acids.
...
PMID:Oxidation of diethylene glycol with ozone and modified Fenton processes. 1199 50
<< Previous
1
2
3
4
5
6
7
8
9
10
Next >>