Gene/Protein Disease Symptom Drug Enzyme Compound
Pivot Concepts:   Target Concepts:
Query: UMLS:C0027819 (neuroblastoma)
 27,800 document(s) hit in 31,850,051 MEDLINE articles (0.00 seconds)

Myosin has been isolated from the clonal lines of murine neuroblastoma and rat glioma cells. Partial characterization of the two cellular myosins indicates that both possess the following properties: (1) the same elution position as rabbit skeletal muscle myosin by Sepharose 4B chromatography; (2) the presence of heavy (molecular weight about 200,000) and light subunit polypeptides by sodium dodecyl sulfate polyacrylamide gel electrophoresis; (3) EDTA and Ca2+ activated but Mg2+-inhibited ATPase activity in 0.6 M KCl; and (4) binding to rabbit skeletal muscle F-actin which is inhibited by Mg2+-ATP. For both mouse neuroblastoma and rat glioma cells, approximately 0.5-1.5% of the total cell protein is present as myosin. Cellular myosin appears to be indistinguishable in quantity and biochemical properties regardless of whether it is isolated from monolayer or suspension neuroblastoma cells.
 ...
PMID:Isolation and characterization of myosin from cloned rat glioma and mouse neuroblastoma cells. 13 25

The organization of actin in mouse neuroblastoma and chicken dorsal root ganglion (DRG) nerve cells was investigated by means of a variety of electron microscope techniques. Microspikes of neuroblastoma cells contained bundles of 7- to 8-nm actin filaments which originated in the interior of the neurite. In the presence of high concentrations of Mg++ ion, filaments in these bundles became highly ordered to form paracrystals. Actin filaments, but not bundles, were observed in growth cones of DRG cells. Actin was localized in the cell body, neurites, and microspikes of both DRG and neuroblastoma nerve cells by fluorescein-labeled S1. Myosin was localized primarily in the neurites of chick DRG nerve cells with fluorescein-labeled anti-brain myosin antibody. This antibody also stained stress fibers in fibroblasts and myoblasts but did not stain muscle myofibrils.
 ...
PMID:Studies on the organization and localization of actin and myosin in neurons. 37 13

Specific anti-actin and anti-myosin antibodies were shown to react in single and double immunofluorescence sandwich tests with identical sites in non-muscle cells in frozen sections of tissues and in cultured cells. In tissues, both antibodies reacted with liver cell membranes, parts of renal glomeruli, brush borders and peritubular fibrils of renal tubules, brain synaptic junctions, and membranes of lymphoid cells in thymic medulla, lymph nodes and spleen. Both antibodies reacted strongly with long parallel cytoplasmic fibrils in cultured fibroblasts, and with disrupted fibrils in cytochalasin-B treated cells. In neuroblastoma cells both antibodies gave prominent staining of growth cones and microspikes. The observation that the distribution of myosin parallels that of actin in non-muscle cells argues strongly in favour of a functional interaction between the two molecules in the generation of contractile activity in non-muscle cells.
 ...
PMID:Distribution of actin and myosin in muscle and non-muscle cells. 38 Aug 11

Monolayers of cultured neuroblastoma cells were examined for immunofluorescent reactivity with antibodies directed against actin, myosin or intermediate filaments. In well spread cells, antibody to intermediate filaments stained an intricate cytoplasmic network which extended as filament bundles into cell processes; in poorly spread or rounded cells, the antibody stained thick juxtanuclear filament bundles. By contrast, antibodies to actin or myosin reacted with microspikes and with axonal growth cones. The different topographical distribution of actin, myosin and intermediate filaments suggests that while actin and myosin may have roles in axon elongation, intermediate filaments may function as an internal cytoskeleton as well as in axoplasmic transport. The different distribution of intermediate filaments in well spread compared with rounded cells suggests that the cell makes its filaments prior to axon development and that the filaments subsequently unwind and migrate into the cell processes to form the axon skeleton.
 ...
PMID:Immunofluorescence demonstrates the distribution of actin, myosin and intermediate filaments in cultured neuroblastoma cells. 39 54

We have generated a polyclonal antibody against myosin II from a neuronally derived cell line in order to assess potential roles for myosin II in growth cone movement and synaptic transmission. The distribution of neuronal myosin II, in isolated cells as well as in tissues of the adult rat brain and spinal cord, was examined at the light microscopic and ultrastructural levels. In isolated neuroblastoma cells and dorsal root ganglion neurons, myosin II was found at the leading edge of growth cones, within neuritic processes and cell soma, and adjacent to the plasma membrane. The subcellular distribution of myosin II overlapped significantly with that of both actin and single-headed myosin I. These results implicate both myosin I and myosin II as molecular motors required for neurite elongation and growth cone motility. An exclusive postsynaptic distribution of myosin II in neurons of the mature central nervous system suggests that myosin II cannot play a role in the mobilization of synaptic vesicles, but could participate in synaptic plasticity.
 ...
PMID:Myosin II distribution in neurons is consistent with a role in growth cone motility but not synaptic vesicle mobilization. 173 5

Clones possessing inserts of brain myosin II have been obtained by screening a rat brain cDNA expression library with a polyclonal antibody, raised against myosin II from the mouse neuroblastoma cell line, Neuro-2A. A partial sequence comprising the 3' coding and non-coding regions of the myosin message has been determined which is markedly different from other myosin sequences. The derived amino-acid sequence comprises the C-terminal 90 amino acids: VSS(PO4)LKNKLRRGDLPFVVTRRLVRKGTLELS(PO4)DDDDESKASLINETQPPQCLDQQ LDQQ LDQLFNWPVNAGCVCGWGVEQTQGEEAVHKCRT(CO2H). This sequence encompasses regions homologous to both the casein kinase II and protein kinase C heavy-chain phosphorylation sites. The non-helical "tail-piece" is considerably longer (an additional 39 amino acid residues) than found in other myosins. Northern blot analysis demonstrates this myosin II message to be unique to cerebral cortex, with no expression in all other non-cortical brain regions and peripheral tissues tested. Our results suggest functional diversity for myosin II isozymes within the brain.
 ...
PMID:A unique cellular myosin II exhibiting differential expression in the cerebral cortex. 923 40

We have developed a new method for the rapid isolation of tropomyosin-containing microfilaments from cultured cells using anti-tropomyosin monoclonal antibodies. Anti-tropomyosin monoclonal antibodies induce the bundle formation of microfilaments, which can be easily collected by low speed centrifugation. Electron microscopic studies of the isolated microfilaments show periodic localization of tropomyosin along the microfilaments of nonmuscle cells with a 33-34 nm repeat. Furthermore, the isolated microfilaments have the ability to activate the Mg2+-ATPase activity of skeletal muscle myosin to almost the same extent as skeletal muscle F-actin (filamentous actin). This microfilament isolation method is applicable to a variety of cell types, including REF-52 cells (an established rat embryo line), L6 myoblasts, 3T3 fibroblasts, Chinese hamster ovary cells, baby hamster kidney (BHK-21) cells, mouse neuroblastoma cells, gerbil fibroma cells, and chicken embryo fibroblasts. Sodium dodecyl sulfate-polyacrylamide gel analysis shows that, in addition to actin, microfilaments isolated from REF-52 cells contain five species of tropomyosin with apparent Mr = 40,000, 36,500, 35,000, 32,400, and 32,000, alpha-actinin, and as yet unknown proteins with apparent Mr = 83,000 and 37,000. The molar ratio of total tropomyosin (dimer) to actin in the isolated microfilaments is 1:8. The patterns of these multiple forms of tropomyosin were found to change when REF-52 cells were transformed with SV40 or adenovirus type 5.
 ...
PMID:Isolation and characterization of tropomyosin-containing microfilaments from cultured cells. 613 66

Antibodies were raised against a cytoskeleton-associated, nonphosphorylated, 230,000-dalton bovine lens polypeptide (designated p230), and rendered monospecific by using a novel immunoaffinity technique. In immunofluorescence and electron microscopy of cultured fibroblasts, as well as of various other cells (endothelial, epithelial, lenticular, monocytes, neuroblastoma cells) and tissues (human kidney and liver), p230 was localized as a distinct subplasmalemmal layer in the peripheral cytoplasm of the cells. It constituted less than 0.3% of the total cellular protein in cultured fibroblasts and was not extractable with Triton X-100. In detergent-extracted cytoskeletal preparations of cultured fibroblasts, p230 remained as an elaborate peripheral network that showed a distribution distinctly different from that of the major cytoskeletal structures, stress fibers, cortical myosin, vinculin, and intermediate filaments (IF). The distribution was not dependent on the presence of intact stress fibers or microtubules, as shown by double-fluorescence microscopy of cells exposed to cytochalasin B or cultured in the presence of monensin and of cold-treated cells. Upon demecolcine-induced reorganization of intermediate filaments, however, the localization of p230 was rapidly altered to a dense plaque underneath the perinuclear aggregate of intermediate filaments. On the other hand, p230 seemed to colocalize with the detergent-resistant cell surface lamina, visualized in fluorescence microscopy with fluorochrome-coupled wheat germ agglutinin-lectin. The results suggest that p230 is part of a cell surface- and cytoskeleton-associated subplasmalemmal structure that may play an important role in cell surface-cytoskeleton interaction in various cells both in vitro and in vivo.
 ...
PMID:Immunolocalization of a novel, cytoskeleton-associated polypeptide of Mr 230,000 daltons (p230). 633 21

Smooth-muscle antibodies (SMA) were detected in 16 of 18 (89%) children with neuroblastoma and in 43 of 172 (25%) pediatric hospital patients without malignancies. The SMA were mainly of the IgG class. The most common immunofluorescence pattern was SMA-V (vessel) and titers did not exceed 1:160. Absorption and immunodiffusion tests with action (from rabbit skeletal muscle) showed that the SMA associated with neuroblastoma are mainly directed against actin, although different antigen specificities (myosin, meromyosin) are probably involved in some cases. In both chronic active hepatitis and neuroblastoma, SMA would represent a specific response to intracellular contractile proteins (mainly actin) induced by tissue damage. A feedback role in controlling cellular proliferation has been postulated for experimentally raised SMA. This would be relevant in cases of malignancy.
 ...
PMID:Smooth-muscle antibodies in children with neuroblastoma. 677 92

Antisera against myosin of human normal skeletal muscle and against rhabdomyoblasts of autopsy-proved rhabdomyosarcoma were raised in white rabbits, purified, and assessed for their usefulness in the diagnosis of childhood rhabdomyosarcoma. The specificity of the antisera was tested by both immunofluorescence and immunoperoxidase methods in seven cases of autopsy-proved rhabdomyosarcoma, five of malignant lymphoma, three of neuroblastoma, and two of Ewing's sarcoma. Antimyosin serum tested positive for all cases of rhabdomyosarcoma and negative for other types of tumor. Antirhabdomyoblast serum was positive in all cases of rhabdomyosarcoma and cross-reacted with cases of neuroblastoma and Ewing's tumor, although the intensity of staining was much decreased. Our results indicate that antimyosin serum is specific for childhood rhabdomyosarcoma and can be used to differentiate this from other childhood "round cell" tumors.
 ...
PMID:Antimyosin and antirhabdomyoblast sera: their use for the diagnosis of childhood rhabdomyosarcoma. 689 93


1 2 3 Next >>